PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Medtr3g098810.1
Common NameMTR_3g098810
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Trifolieae; Medicago
Family NAC
Protein Properties Length: 242aa    MW: 27406 Da    PI: 8.7082
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Medtr3g098810.1genomeMtView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM149.51.7e-46141411128
              NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevls 94 
                      lppGf F+Ptdeelv +yLk k+ + +l++ ++i+e++++k++PwdLp ++  +e++ yfFs+++ ky++++r nr+t+sgyWkatg+dk+v +
  Medtr3g098810.1  14 LPPGFCFQPTDEELVFHYLKCKIFSYQLPA-SIIPEINVCKFDPWDLPGNC--GEQDKYFFSSKEAKYRNSNRMNRTTSSGYWKATGSDKKVSV 104
                      79****************************.89***************544..77899**********************************99 PP

              NAM  95 k...kgelvglkktLvfykgrapkgektdWvmheyrl 128
                      +   ++   g++k+Lvfy+g++p+g++t+W+mheyrl
  Medtr3g098810.1 105 SsslSNGIAGIRKSLVFYQGKSPNGSRTHWIMHEYRL 141
                      86776667***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.06E-5310170IPR003441NAC domain
PROSITE profilePS5100551.44714170IPR003441NAC domain
PfamPF023653.6E-2415141IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 242 aa     Download sequence    Send to blast
MEKLNFVKNG VSKLPPGFCF QPTDEELVFH YLKCKIFSYQ LPASIIPEIN VCKFDPWDLP  60
GNCGEQDKYF FSSKEAKYRN SNRMNRTTSS GYWKATGSDK KVSVSSSLSN GIAGIRKSLV  120
FYQGKSPNGS RTHWIMHEYR LVSLGTTACN QLQNYANEIG NWVLCRIFTK KRSNIENGYM  180
MKSNIVMNTN VEVAQPRFFD FMRVHNLASD PTTHFSISSS CSSSSEVSSS EERCSDIYTD  240
F*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3swm_A4e-471417320171NAC domain-containing protein 19
3swm_B4e-471417320171NAC domain-containing protein 19
3swm_C4e-471417320171NAC domain-containing protein 19
3swm_D4e-471417320171NAC domain-containing protein 19
3swp_A4e-471417320171NAC domain-containing protein 19
3swp_B4e-471417320171NAC domain-containing protein 19
3swp_C4e-471417320171NAC domain-containing protein 19
3swp_D4e-471417320171NAC domain-containing protein 19
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1467471e-152AC146747.7 Medicago truncatula clone mth2-14h5, complete sequence.
GenBankCU0626591e-152CU062659.10 M.truncatula DNA sequence from clone MTH2-14C23 on chromosome 3, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003602768.10.0NAC transcription factor-like protein
SwissprotQ9FY931e-70NAC83_ARATH; NAC domain-containing protein 83
TrEMBLG7J3B80.0G7J3B8_MEDTR; NAC transcription factor-like protein
STRINGGLYMA05G38380.11e-105(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF70434139
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G13180.16e-67NAC domain containing protein 83
Publications ? help Back to Top
  1. Young ND, et al.
    The Medicago genome provides insight into the evolution of rhizobial symbioses.
    Nature, 2011. 480(7378): p. 520-4
    [PMID:22089132]